PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H00609.1.p
Common NameEUGRSUZ_H00609, LOC104456408
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 713aa    MW: 78575.1 Da    PI: 6.5979
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H00609.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.2e-212075156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +++ +++t++q+++Le++F+++++p++++r eL+++lgL  rq+k+WFqNrR+++k
  Eucgr.H00609.1.p 20 KKRYHRHTAHQIQRLEAMFRECPHPDEKQRMELSRELGLAPRQIKFWFQNRRTQMK 75
                      688999***********************************************998 PP

2START170.11.4e-532184422206
                       HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
             START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       +a  a++e++++a+ +ep+W+ks     +++n + + + f+++ +       ++ea+r+s+vv m+   l   +++++ +W e ++    +a+
  Eucgr.H00609.1.p 218 IAANALDEFLRLAQTDEPLWMKSTtdgrDNLNLESYERMFPRASShlknpdVRVEASRESRVVMMNGLALIDMFMNSN-KWAELFPaivsAAK 309
                       577899*********************99999999999999988899***99**************************.************** PP

                       EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
             START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                       t+evis+g      g lqlm+ elq+lspl p R+f+f+Ry++q + g w+ivdvS d  ++ +  +   R+++lpSg+li++++ng+skvtw
  Eucgr.H00609.1.p 310 TIEVISPGlltsqnGSLQLMYEELQVLSPLIPtREFYFLRYCQQIEPGLWAIVDVSFDLSRYDQ-FAFQSRSQRLPSGCLIQDLPNGYSKVTW 401
                       ***************************************************************9.79999*********************** PP

                       EE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 167 vehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                       vehv+ ++++p h l+r l+ sgla+ga +w atl+r ce+
  Eucgr.H00609.1.p 402 VEHVEIEDKTPvHRLYRDLIYSGLAFGAERWIATLERMCER 442
                       ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.18E-21677IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-23979IPR009057Homeodomain-like
PROSITE profilePS5007118.1721777IPR001356Homeobox domain
SMARTSM003896.0E-201881IPR001356Homeobox domain
PfamPF000462.7E-182075IPR001356Homeobox domain
CDDcd000861.35E-182078No hitNo description
PROSITE patternPS0002705275IPR017970Homeobox, conserved site
PROSITE profilePS5084852.047208445IPR002913START domain
SuperFamilySSF559611.37E-34209443No hitNo description
CDDcd088751.74E-116212441No hitNo description
SMARTSM002347.6E-47217442IPR002913START domain
PfamPF018522.1E-46218442IPR002913START domain
Gene3DG3DSA:3.30.530.207.1E-7278436IPR023393START-like domain
SuperFamilySSF559616.46E-23463704No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MDFGGGSGGD HDGSDHQKRK KRYHRHTAHQ IQRLEAMFRE CPHPDEKQRM ELSRELGLAP  60
RQIKFWFQNR RTQMKAQHER ADNCALRAEN DRIRCENIVI REALRNVICP SCGTVPSGED  120
SYFDEQKLRM ENAHLKEELD RVSSIAAKYI GRPMSQLPPV QPIHIASLDL TMSSLGAHGL  180
AGPSLDLDLL PGSSSSVPHL PFQAVVFSDM DKSLMADIAA NALDEFLRLA QTDEPLWMKS  240
TTDGRDNLNL ESYERMFPRA SSHLKNPDVR VEASRESRVV MMNGLALIDM FMNSNKWAEL  300
FPAIVSAAKT IEVISPGLLT SQNGSLQLMY EELQVLSPLI PTREFYFLRY CQQIEPGLWA  360
IVDVSFDLSR YDQFAFQSRS QRLPSGCLIQ DLPNGYSKVT WVEHVEIEDK TPVHRLYRDL  420
IYSGLAFGAE RWIATLERMC ERIACLMVTG SSTRDTRGVI PSPDGKRSMM KLAQRMVNNF  480
CSSISTSSSR QQRWTTLSGS SEVGVRVALH KSTDPGQPNG VVLSAATTIW LPLSPQNVFN  540
FFKDERTRAQ WDVLSNGNAV QEVAHLANGS HPGNCISVLR AFNTSQNNML ILQESCIDSS  600
GSLIVYCPVD LPAINLAMSG EDPSYIPLLP SGFTISPDGG PDPGDGASSS SAAAAGQGST  660
SRSAGSLMTV AFQILVSSLP SAKLNLESVT TVNNLISTTV HQIKAALNCP GS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H00609.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069492.10.0PREDICTED: homeobox-leucine zipper protein HDG11
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A059AW260.0A0A059AW26_EUCGR; Uncharacterized protein
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11